thefrontkit Blog

Insights, tutorials, and updates from thefrontkit

AI Chatbot vs Live Chat: When Each Wins in 2026
nextjsai-chatbotlive-chatsupportai-uxdeflectionhandoff6 min read

AI Chatbot vs Live Chat: When Each Wins in 2026

The AI chatbot vs live chat framing is wrong. They do different jobs. A look at when each wins, the handoff pattern that matters, and what teams get wrong.

Gaurav GuhaJune 3, 2026
ChartMogul Alternatives for SaaS Founders 2026
nextjssaas-metricschartmogulmrralternativesbaremetricsprofitwelldashboard6 min read

ChartMogul Alternatives for SaaS Founders 2026

5 ChartMogul alternatives compared on price, MRR accuracy, churn, and ownership. Baremetrics, ProfitWell, Stripe Sigma, open-source, and self-hosted picks.

Gaurav GuhaJune 3, 2026
Cin7 Alternatives: 6 Self-Hosted Inventory Management Options for 2026
inventorycin7alternativeszohoodooerpnextself-hostedwarehouse6 min read

Cin7 Alternatives: 6 Self-Hosted Inventory Management Options for 2026

Cin7 Core starts at $349/month. 6 alternatives compared: Zoho Inventory, Sortly, inFlow, ERPNext, Odoo Inventory, and building your own in Next.js.

Gaurav GuhaJune 3, 2026
The Cohort Retention Chart Most SaaS Dashboards Get Wrong
nextjssaas-metricscohort-retentionchurnpmfanalyticsdashboard6 min read

The Cohort Retention Chart Most SaaS Dashboards Get Wrong

Three specific ways SaaS dashboards get cohort retention math wrong, why it makes you misread product-market fit, and the calculation that actually holds up.

Gaurav GuhaJune 3, 2026
Datadog Alternatives: 6 Self-Hosted Observability Options for 2026
observabilitydatadogalternativesgrafanaprometheussignozai-opsmonitoring7 min read

Datadog Alternatives: 6 Self-Hosted Observability Options for 2026

Datadog bills surprise teams every quarter. 6 alternatives: Grafana Cloud, New Relic, SigNoz, Prometheus + Grafana, Better Stack, and building a custom AI ops dashboard with NeuralDesk.

Gaurav GuhaJune 3, 2026
Hootsuite Alternatives: 6 Self-Hosted Social Media Dashboards for 2026
nextjssocial-mediahootsuitealternativesbufferlaterself-hostedmixpost6 min read

Hootsuite Alternatives: 6 Self-Hosted Social Media Dashboards for 2026

Hootsuite Professional is $99/user/month. 6 alternatives compared: Buffer, Later, Sprout, Mixpost (self-hosted), Postiz (open source), and building your own.

Gaurav GuhaJune 3, 2026
How to Build a Finance Dashboard in Next.js (2026)
nextjsfinancedashboardplaidbudgetingtransactionstailwindshadcn7 min read

How to Build a Finance Dashboard in Next.js (2026)

Practical walkthrough of a Next.js personal finance dashboard: account aggregation, transaction normalization, budget tracking, and the data model that holds up across banks.

Gaurav GuhaJune 3, 2026
How to Build a Sales Dashboard in Next.js (2026)
nextjssalesdashboardpipelinecrmforecastingtailwindshadcn8 min read

How to Build a Sales Dashboard in Next.js (2026)

Practical walkthrough of a Next.js sales dashboard: pipeline tracking, quota progress, forecast accuracy, activity metrics, and the data model that holds up across reps.

Gaurav GuhaJune 3, 2026
How to Build a Social Media Dashboard in Next.js (2026)
nextjssocial-mediadashboardschedulinganalyticstailwindshadcn7 min read

How to Build a Social Media Dashboard in Next.js (2026)

A practical walkthrough for a Next.js social media dashboard: post scheduling, multi-account auth, analytics, content calendar, and the data model that holds up at scale.

Gaurav GuhaJune 3, 2026
How to Build an Inventory Management App in Next.js (2026)
nextjsinventoryskuwarehousestockpurchase-orderstailwindshadcn7 min read

How to Build an Inventory Management App in Next.js (2026)

Practical walkthrough of a Next.js inventory management app: SKU model, multi-warehouse, stock movements, purchase orders, and the data model that holds up at real volume.

Gaurav GuhaJune 3, 2026
Intercom Alternatives: AI Chatbot Options You Can Self-Host 2026
nextjsai-chatbotintercomalternativesfinragself-hostedai-ux-kit6 min read

Intercom Alternatives: AI Chatbot Options You Can Self-Host 2026

Intercom's Fin charges $0.99 per AI resolution. 6 alternatives that let you self-host the chatbot, own the LLM logic, and skip per-resolution pricing.

Gaurav GuhaJune 3, 2026
Inventory Templates That Handle Multi-Warehouse Reality
inventorywarehousemulti-warehousestockfulfillmentlogisticsfounder-voice7 min read

Inventory Templates That Handle Multi-Warehouse Reality

Most inventory templates assume one warehouse. Real operations have 3-15. Five things that break: stock allocation, transfers, fulfillment logic, reorder points, and the reporting layer.

Gaurav GuhaJune 3, 2026
Mint Alternatives: 6 Personal Finance Options for 2026
financemintalternativesmonarchcopilotynabpersonal-financebudgeting7 min read

Mint Alternatives: 6 Personal Finance Options for 2026

Mint shut down in March 2024. Two years later, 6 alternatives compared: Monarch, Copilot, YNAB, Empower, Tiller, and self-hosted with the Finance Dashboard Kit.

Gaurav GuhaJune 3, 2026
Pipedrive Alternatives: 6 Self-Hosted Sales Dashboard Options for 2026
salescrmpipedrivealternativeshubspotclosetwentyespocrmself-hosted7 min read

Pipedrive Alternatives: 6 Self-Hosted Sales Dashboard Options for 2026

Pipedrive Power is $49/user/month. 6 alternatives: HubSpot Free, Close, Salesflare, Twenty (open source), EspoCRM, and building your own sales dashboard in Next.js.

Gaurav GuhaJune 3, 2026
Teachable Alternatives: Self-Hosted LMS for Course Creators 2026
nextjslmsteachablealternativescourse-platformthinkificmoodleeducation6 min read

Teachable Alternatives: Self-Hosted LMS for Course Creators 2026

Teachable takes 5% transaction fees and locks students to their domain. 6 alternatives: Thinkific, LearnWorlds, Moodle, Sensei LMS, Open edX, and building your own LMS in Next.js.

Gaurav GuhaJune 3, 2026
TradingView Alternatives: Self-Hosted Trading Dashboard Options 2026
nextjstradingtradingviewalternativescryptofintechdashboardself-hosted7 min read

TradingView Alternatives: Self-Hosted Trading Dashboard Options 2026

TradingView Premium locks data behind their cloud. 6 alternatives for traders who want full control: ThinkOrSwim, Coinigy, Freqtrade, Lightweight Charts, and building your own.

Gaurav GuhaJune 3, 2026
Why AI Ops Dashboards Don't Prevent Incidents
ai-opsobservabilityincident-managementdatadogon-callfounder-voice7 min read

Why AI Ops Dashboards Don't Prevent Incidents

AI ops dashboards promise to prevent incidents and rarely do. Five reasons: prediction without action, alert fatigue with AI sauce, missing runbook context, no feedback loop, and on-call workflow ignored.

Gaurav GuhaJune 3, 2026
Why Most Crypto Dashboards Break in a Real Market
nextjscryptotradingdashboardportfolio-trackerfintechccxtwebsocket6 min read

Why Most Crypto Dashboards Break in a Real Market

Most crypto portfolio dashboards work fine in normal markets and break when volatility hits. Four specific failure modes: rate limits, stale WebSockets, wrong cost basis, and token migrations.

Gaurav GuhaJune 3, 2026
Why Most Budget Apps Fail After 90 Days
financebudgetpersonal-financebehavioralmintmonarchynab6 min read

Why Most Budget Apps Fail After 90 Days

Most budget apps get abandoned after 3 months. Five reasons: transaction backlog, miscategorized history, broken bank connections, budget categories that don't fit life, and reports that don't change behavior.

Gaurav GuhaJune 3, 2026
Why Most LMS Templates Fail Course Creators
nextjslmscourse-platformeducationcreator-economyteachablethinkific7 min read

Why Most LMS Templates Fail Course Creators

Most LMS templates on Google are video catalogs with a checkout slapped on. Five things real course creators need that templates skip: video player, progress, drip, taxes, and email lifecycle.

Gaurav GuhaJune 3, 2026
Why Sales Dashboards Stop Getting Opened After 6 Weeks
salesdashboardcrmfounder-voicesalesforcepipedriveengagement6 min read

Why Sales Dashboards Stop Getting Opened After 6 Weeks

Most sales dashboards lose reps and managers after the first month and a half. Five reasons: data lag, vanity metrics, no decision triggers, broken CRM sync, and reports nobody asked for.

Gaurav GuhaJune 3, 2026
Why Self-Hosted Help Desks Stall After Six Months
nextjshelp-deskself-hostedsupportzammadchatwootfreescout6 min read

Why Self-Hosted Help Desks Stall After Six Months

Self-hosted help desks start strong then stall. Five specific failure modes: email deliverability decay, knowledge base rot, brittle automations, mobile, and reporting that dies at scale.

Gaurav GuhaJune 3, 2026
Why Social Media Dashboards Become Noise After 30 Days
nextjssocial-mediadashboardanalyticsengagementfounder-voice6 min read

Why Social Media Dashboards Become Noise After 30 Days

Most social media dashboards stop getting opened after a month. Five specific reasons: vanity metric overload, no decision triggers, broken integrations, calendar tax, and reporting that nobody asked for.

Gaurav GuhaJune 3, 2026
Zendesk Alternatives: 6 Self-Hosted Help Desk Options for 2026
nextjshelp-deskzendeskalternativessupportticketingzammadchatwoot6 min read

Zendesk Alternatives: 6 Self-Hosted Help Desk Options for 2026

Zendesk's per-agent pricing punishes growth. 6 alternatives compared: Zammad, FreeScout, Chatwoot, Help Scout, Freshdesk, and building your own in Next.js.

Gaurav GuhaJune 3, 2026
How to Choose an Accessible Next.js Starter (2026)
nextjsaccessibilitya11y-starter-kitwcagtemplatereacttailwindshadcncompliance13 min read

How to Choose an Accessible Next.js Starter (2026)

A practical guide to picking an accessible Next.js starter kit. What separates a real WCAG AA codebase from a template with one ARIA attribute on a button.

Gaurav GuhaMay 21, 2026
Add Clerk Auth to a Next.js Template (2026)
nextjsclerkauthintegrationtutorialtailwindshadcnrbac10 min read

Add Clerk Auth to a Next.js Template (2026)

A practical guide to wiring Clerk into any Next.js template. Sign-in, organizations, role-based access, and the protected routes pattern that holds up.

Gaurav GuhaMay 21, 2026
Add Razorpay to a Next.js Template (2026)
nextjsrazorpaypaymentsindiaupiintegrationtutorialwebhooks10 min read

Add Razorpay to a Next.js Template (2026)

A practical guide to wiring Razorpay into a Next.js template for Indian payments. Checkout, subscriptions, UPI, and webhooks done right.

Gaurav GuhaMay 21, 2026
Add Stripe Payments to a Next.js Template (2026)
nextjsstripepaymentssubscriptionsbillingintegrationtutorialwebhooks10 min read

Add Stripe Payments to a Next.js Template (2026)

A practical guide to wiring Stripe Checkout, subscriptions, and webhooks into a Next.js template. The patterns that survive contact with real customers.

Gaurav GuhaMay 21, 2026
Best AI Chatbot Templates 2026
nextjsai-chatbotaitemplatestreamingragreacttailwind6 min read

Best AI Chatbot Templates 2026

We compared 7 AI chatbot templates and platforms on streaming, RAG, multi-model support, and customization. Honest picks for 2026.

Gaurav GuhaMay 21, 2026
Best Booking & Scheduling Templates 2026
nextjsbookingschedulingtemplatecalendarappointmentsreacttailwind7 min read

Best Booking & Scheduling Templates 2026

We compared 7 Next.js and React booking templates on availability rules, calendar sync, payments, and admin depth. Honest picks for 2026.

Gaurav GuhaMay 21, 2026
Best Help Desk & Support Ticket Templates 2026
nextjshelp-desksupportticketingtemplatereacttailwindcustomer-support6 min read

Best Help Desk & Support Ticket Templates 2026

We compared 7 help desk templates and platforms on inbox quality, SLA tracking, knowledge base, and customization. Honest picks for 2026.

Gaurav GuhaMay 21, 2026
Best LMS Templates & Course Platforms 2026
nextjslmscourse-platformtemplateeducationreacttailwindlearning7 min read

Best LMS Templates & Course Platforms 2026

We compared 7 LMS templates and course platforms on video, progress tracking, quizzes, and monetization. Honest picks for 2026.

Gaurav GuhaMay 21, 2026
Best SaaS Metrics Dashboard Templates 2026
nextjssaas-metricsmrrchurntemplatedashboardreacttailwind6 min read

Best SaaS Metrics Dashboard Templates 2026

We compared 6 SaaS metrics dashboard templates and tools on MRR accuracy, cohort retention, churn analytics, and customization. Honest picks for 2026.

Gaurav GuhaMay 21, 2026
Best Trading & Fintech Dashboard Templates 2026
nextjstradingfintechtemplatedashboardchartsreacttailwind6 min read

Best Trading & Fintech Dashboard Templates 2026

We compared 7 trading and fintech dashboard templates on real-time data, charts, portfolio tracking, and customization. Honest picks for 2026.

Gaurav GuhaMay 21, 2026
Connect Supabase to a Next.js Template (2026)
nextjssupabaseauthdatabaseintegrationtutorialtailwindshadcn11 min read

Connect Supabase to a Next.js Template (2026)

A practical guide to wiring Supabase Auth, Database, and Storage into any Next.js template. Setup steps, code, and the gotchas nobody warns you about.

Gaurav GuhaMay 21, 2026
Deploy a Next.js Template to Vercel (2026)
nextjsverceldeploymenttutorialci-cddomainsedgetailwind9 min read

Deploy a Next.js Template to Vercel (2026)

A practical guide to deploying any Next.js template to Vercel. Domains, env vars, edge config, ISR, cron jobs, and the gotchas that cost teams a launch day.

Gaurav GuhaMay 21, 2026
How to Build a Blog with CMS in Next.js (2026)
nextjsblogcmsblog-cms-kittutorialtailwindtiptapseo9 min read

How to Build a Blog with CMS in Next.js (2026)

A practical walkthrough of building a production blog with admin CMS in Next.js, with editor, media library, scheduling, and SEO done right.

Gaurav GuhaMay 21, 2026
How to Build a Booking App in Next.js (2026)
nextjsbookingschedulingcalendartutorialtailwindshadcnappointments10 min read

How to Build a Booking App in Next.js (2026)

A practical walkthrough of building a production booking and scheduling app in Next.js. Calendar, availability rules, customer portal, and admin done right.

Gaurav GuhaMay 21, 2026
How to Build a CRM in Next.js (2026)
nextjscrmcrm-dashboard-kittutorialtailwindshadcnpipelinekanban11 min read

How to Build a CRM in Next.js (2026)

A practical walkthrough of building a production CRM in Next.js, with the pipeline, contacts, deals, and reports you actually need.

Gaurav GuhaMay 21, 2026
How to Build a Help Desk in Next.js (2026)
nextjshelp-desksupportticketingtutorialtailwindshadcncustomer-support8 min read

How to Build a Help Desk in Next.js (2026)

A practical walkthrough of building a production help desk and support ticket system in Next.js. Inbox, agent assignment, SLA, and customer portal done right.

Gaurav GuhaMay 21, 2026
How to Build a Kanban App in Next.js (2026)
nextjskanbankanban-pm-kittutorialtailwinddrag-and-dropproject-management9 min read

How to Build a Kanban App in Next.js (2026)

A practical walkthrough of building a production kanban project management app in Next.js, with drag-and-drop, sprints, and a real data model.

Gaurav GuhaMay 21, 2026
How to Build a SaaS in Next.js (2026)
nextjssaassaas-starter-kittutorialtailwindshadcnauthstripe12 min read

How to Build a SaaS in Next.js (2026)

A practical walkthrough of building a production SaaS in Next.js, with the architecture, screens, and accessibility you actually need to ship.

Gaurav GuhaMay 21, 2026
How to Build a SaaS Metrics Dashboard in Next.js
nextjssaas-metricsmrrchurndashboardtailwindshadcnanalytics2 min read

How to Build a SaaS Metrics Dashboard in Next.js

A practical walkthrough of building a SaaS metrics dashboard in Next.js. MRR, churn, LTV, cohort analysis, and the data model that holds up.

Gaurav GuhaMay 21, 2026
How to Build a Trading Dashboard in Next.js (2026)
nextjstradingfintechdashboardtutorialtailwindshadcnreal-time8 min read

How to Build a Trading Dashboard in Next.js (2026)

A practical walkthrough of building a production trading and fintech dashboard in Next.js. Real-time prices, portfolio, charts, and the data model that holds up.

Gaurav GuhaMay 21, 2026
How to Build an AI Chatbot in Next.js (2026)
nextjsai-chatbotaitutorialtailwindshadcnstreamingrag8 min read

How to Build an AI Chatbot in Next.js (2026)

A practical walkthrough of building a production AI chatbot in Next.js. Streaming, citations, conversation history, deployment, and the patterns that hold up.

Gaurav GuhaMay 21, 2026
How to Build an E-commerce Site in Next.js (2026)
nextjsecommerceecommerce-kittutorialtailwindstripestorefrontcart10 min read

How to Build an E-commerce Site in Next.js (2026)

A practical walkthrough of building a production e-commerce site in Next.js, with storefront, cart, checkout, and admin done right.

Gaurav GuhaMay 21, 2026
How to Build an HR Dashboard in Next.js (2026)
nextjshrhr-dashboard-kittutorialtailwindshadcnleave-managementonboarding10 min read

How to Build an HR Dashboard in Next.js (2026)

A practical walkthrough of building a production HR dashboard in Next.js, with employees, leave, attendance, and onboarding done right.

Gaurav GuhaMay 21, 2026
How to Build an LMS in Next.js (2026)
nextjslmscourse-platformeducationtutorialtailwindshadcnlearning9 min read

How to Build an LMS in Next.js (2026)

A practical walkthrough of building a production learning management system in Next.js. Courses, lessons, progress tracking, quizzes, and admin done right.

Gaurav GuhaMay 21, 2026
How to Choose an AI Ops Dashboard Template (2026)
nextjsai-opsneuraldeskllm-opstemplateprompt-engineeringtailwindshadcnobservability13 min read

How to Choose an AI Ops Dashboard Template (2026)

A practical guide to picking a Next.js AI ops dashboard template. What separates a real LLM operations tool from an admin panel with a chat widget.

Gaurav GuhaMay 21, 2026
How to Choose a Next.js Blog Template in 2026
nextjsblogblog-cms-kittemplatecmsmdxseotailwindshadcn12 min read

How to Choose a Next.js Blog Template in 2026

A practical guide to picking a Next.js blog template. What separates a real CMS-backed blog from a markdown demo with three sample posts.

Gaurav GuhaMay 21, 2026
Set Up Drizzle ORM with a Next.js Template (2026)
nextjsdrizzleormpostgresintegrationtutorialdatabasetypescript9 min read

Set Up Drizzle ORM with a Next.js Template (2026)

A practical guide to wiring Drizzle ORM into any Next.js template. Schema, migrations, server queries, and the patterns that hold up.

Gaurav GuhaMay 21, 2026
How to Choose a Next.js CRM Dashboard Template in 2026
nextjscrmcrm-dashboard-kittemplatereacttailwindshadcnsales-pipelinekanban11 min read

How to Choose a Next.js CRM Dashboard Template in 2026

A practical guide to evaluating Next.js CRM dashboard templates. What separates a real CRM frontend from a contact list with a sidebar.

Gaurav GuhaMay 20, 2026
How to Choose a Next.js Finance Dashboard Template in 2026
nextjsfinancefinance-dashboard-kittemplatereacttailwindshadcnfintechpersonal-finance10 min read

How to Choose a Next.js Finance Dashboard Template in 2026

A practical guide to evaluating Next.js finance dashboard templates. What separates a real fintech UI from a transaction list with charts.

Gaurav GuhaMay 20, 2026
Choosing a Next.js Inventory Template (2026)
nextjsinventoryinventory-management-kittemplatereacttailwindshadcnwarehousesupply-chain10 min read

Choosing a Next.js Inventory Template (2026)

A practical guide to evaluating Next.js inventory management templates. What separates a real warehouse tool from a product list page.

Gaurav GuhaMay 20, 2026
How to Choose a Next.js Kanban Template in 2026
nextjskanbankanban-pm-kittemplatereactproject-managementdrag-and-droptailwindshadcn12 min read

How to Choose a Next.js Kanban Template in 2026

A practical guide to picking a Next.js kanban template. What separates a real project management dashboard from a drag-and-drop board demo.

Gaurav GuhaMay 20, 2026
How to Choose a Next.js Sales Dashboard Template in 2026
nextjssalessales-dashboard-kittemplatereacttailwindshadcnrevenuepipeline10 min read

How to Choose a Next.js Sales Dashboard Template in 2026

A practical guide to evaluating Next.js sales dashboard templates. What separates a real sales performance tool from a revenue chart.

Gaurav GuhaMay 20, 2026
Choosing a Next.js Social Media Dashboard
nextjssocial-mediasocial-media-dashboard-kittemplatereacttailwindshadcnanalyticscontent-calendar11 min read

Choosing a Next.js Social Media Dashboard

A practical guide to evaluating Next.js social media dashboard templates. What separates a real multi-platform tool from a feed card UI.

Gaurav GuhaMay 20, 2026
Best Next.js Dashboard Templates 2026
nextjsdashboardtemplatereacttailwindshadcnadminstarter-kit9 min read

Best Next.js Dashboard Templates 2026

8 Next.js dashboard templates with Tailwind CSS and shadcn/ui, compared on admin panels, analytics, data tables, and dark mode.

Gaurav GuhaApril 13, 2026
EU Accessibility Act Guide for Next.js
eu-accessibility-acteaawcagcompliancenextjsreactaccessibilitylegalprocurement14 min read

EU Accessibility Act Guide for Next.js

The EU Accessibility Act became enforceable on June 28, 2025. Here is what Next.js developers need to know about WCAG AA scope and timelines.

Gaurav GuhaApril 8, 2026
I Built 14 Accessible Next.js Apps with Claude
claude-codeaiaccessibilitywcagnextjsshadcnworkflowanthropic14 min read

I Built 14 Accessible Next.js Apps with Claude

Everyone says AI can't ship accessible code. I built 14 production Next.js apps with Claude Code and every single one passes WCAG 2.1 AA.

Gaurav GuhaApril 8, 2026
shadcn/ui Accessibility Audit 2026
shadcnshadcn-uiaccessibilitywcagwcag-2-2reactradix-uiaudita11y11 min read

shadcn/ui Accessibility Audit 2026

An honest, code-level accessibility audit of every shadcn/ui component. Which ones are WCAG 2.2 AA compliant out of the box, which need work.

Gaurav GuhaApril 8, 2026
Best AI Ops Dashboard Templates in 2026
aillmdashboardtemplatemlopsprompt-engineeringreactnextjstailwindoperations14 min read

Best AI Ops Dashboard Templates in 2026

Need an AI operations dashboard template? We compared 7 options on model management, prompt engineering, token usage monitoring, request logging.

Gaurav GuhaApril 5, 2026
Best Finance Dashboard Templates 2026
financedashboardtemplatebudgetingfintechreactnextjstailwindtransactions13 min read

Best Finance Dashboard Templates 2026

Need a finance dashboard template? We compared 7 options on transaction management, budget tracking, bill payments, savings goals, reporting.

Gaurav GuhaApril 5, 2026
Best Inventory Management Templates 2026
inventorywarehousetemplatesupply-chainecommercereactnextjstailwindstock-management13 min read

Best Inventory Management Templates 2026

Need an inventory management template? We compared 7 options on product catalog management, purchase orders, warehouse operations, stock tracking.

Gaurav GuhaApril 5, 2026
Best Sales Dashboard Templates 2026
salesdashboardtemplatepipelinecrmreactnextjstailwindrevenue13 min read

Best Sales Dashboard Templates 2026

Need a sales dashboard template? We compared 7 options on pipeline visualization, deal management, quota tracking, leaderboards, revenue reporting.

Gaurav GuhaApril 5, 2026
Best HR Dashboard Templates in 2026
hrdashboardtemplateemployee-managementreactnextjstailwindleave-managementattendance10 min read

Best HR Dashboard Templates in 2026

Need an HR dashboard template? We compared 7 options on employee management, leave tracking, attendance, performance reviews, org charts.

Gaurav GuhaMarch 30, 2026
HR Dashboard Template vs Building from Scratch
hrdashboardnextjscomparisonproductivitytemplatebuild-vs-buy7 min read

HR Dashboard Template vs Building from Scratch

Buy an HR dashboard UI kit or build from scratch? Real time, cost, and risk tradeoffs with examples from the HR Dashboard App.

Gaurav GuhaMarch 30, 2026
Next.js HR Dashboard Template Guide 2026
hrdashboardnextjsreacttailwindemployee-managementleave-managementtutorialguide9 min read

Next.js HR Dashboard Template Guide 2026

A practical guide to building HR dashboards with Next.js. Covers employee directory patterns, leave management workflows, attendance tracking, org charts.

Gaurav GuhaMarch 30, 2026
Best AI Chat UI Kits in 2026 (7 Tested)
aichatchatbottemplateui-kitreactnextjstailwindstreaming10 min read

Best AI Chat UI Kits in 2026 (7 Tested)

Looking for an AI chat UI kit or chatbot template? We compared 7 options on streaming support, citation handling, feedback UI, accessibility.

Gaurav GuhaMarch 28, 2026
Best CRM Dashboard Templates in 2026
crmdashboardtemplatesales-pipelinereactnextjstailwindcontact-management10 min read

Best CRM Dashboard Templates in 2026

7 CRM dashboard templates with Kanban pipelines, contact management, deal tracking, and revenue analytics. React and Next.js picks for 2026.

Gaurav GuhaMarch 28, 2026
Best Kanban Board Templates in 2026
kanbanproject-managementtemplatedashboardreactnextjstailwindsprint-planningtask-management9 min read

Best Kanban Board Templates in 2026

Need a kanban board template for your project management dashboard? We compared 7 options on board features, sprint planning, task management.

Gaurav GuhaMarch 28, 2026
Best Social Media Dashboard Templates
social-mediadashboardtemplateanalyticsreactnextjstailwindcontent-calendarreporting10 min read

Best Social Media Dashboard Templates

7 social media dashboard templates with multi-platform analytics, content calendars, post scheduling, and inbox management for 2026.

Gaurav GuhaMarch 28, 2026
15 Accessible Website Examples That Get It Right in 2026
accessibilitywcaga11yexamplesweb-designuxecommercesaas11 min read

15 Accessible Website Examples That Get It Right in 2026

Looking for accessible website examples? We analyzed 15 sites that nail WCAG compliance, from e-commerce to SaaS to government portals.

Gaurav GuhaMarch 4, 2026
Best Next.js Blog Templates 2026
nextjsblogtemplatemdxreacttailwindseo14 min read

Best Next.js Blog Templates 2026

10 Next.js blog templates tested in 2026. Free open-source picks (Vercel, Nextra, Tailwind starter) plus premium kits. Honest picks.

Gaurav GuhaMarch 4, 2026
Best Next.js Landing Page Templates 2026
nextjslanding-pagetemplatetailwindreactsaasstarter-kit11 min read

Best Next.js Landing Page Templates 2026

10 Next.js landing page templates tested in 2026. Free open-source picks (Vercel, Taxonomy, Precedent) plus premium kits with live demos.

Gaurav GuhaMarch 4, 2026
Best Next.js Personal Website Templates
nextjspersonal-websiteportfoliotemplatereacttailwinddeveloper10 min read

Best Next.js Personal Website Templates

9 Next.js personal website and portfolio templates compared on design quality, blog support, dark mode, and performance for 2026.

Gaurav GuhaMarch 4, 2026
Best Next.js Website Templates 2026
nextjstemplatereacttailwindwebsitesaasecommerceportfolio13 min read

Best Next.js Website Templates 2026

15 Next.js website templates compared on screen count, Tailwind support, dark mode, and accessibility. SaaS, dashboards, landings.

Gaurav GuhaMarch 4, 2026
Best React E-commerce Templates 2026
reactecommercetemplatenextjstailwindstorefrontonline-storestripe10 min read

Best React E-commerce Templates 2026

Need a React e-commerce template? We compared 8 options covering storefronts, checkout flows, and admin panels. Honest picks for 2026.

Gaurav GuhaMarch 4, 2026
Best shadcn Dashboard Templates 2026
shadcndashboardtemplatereactnextjstailwindadminradix-ui13 min read

Best shadcn Dashboard Templates 2026

We tested 10 shadcn dashboard templates (free and paid) on component count, accessibility, dark mode, and real SaaS usability. Honest picks.

Gaurav GuhaMarch 4, 2026
Best Tailwind Dashboard Templates 2026
tailwinddashboardtemplateadminreactnextjscsssaas12 min read

Best Tailwind Dashboard Templates 2026

11 Tailwind CSS dashboard templates tested in real projects. Admin panels, SaaS dashboards, CRM, and analytics compared. Honest picks.

Gaurav GuhaMarch 4, 2026
Figma Design Tokens: A Complete Guide
figmadesign-tokensdesign-systemcsstailwindreactfrontend10 min read

Figma Design Tokens: A Complete Guide

Step-by-step guide to setting up design tokens in Figma with WCAG-compliant color contrast. Sync to Tailwind CSS and shadcn/ui themes.

Gaurav GuhaMarch 4, 2026
How to Make a Website Accessible (Guide)
accessibilitywcaga11yreacthtmlkeyboard-navigationscreen-readerweb-development10 min read

How to Make a Website Accessible (Guide)

A practical guide to making your website accessible. Covers WCAG AA compliance, semantic HTML, keyboard navigation, color contrast, screen readers.

Gaurav GuhaMarch 4, 2026
ARIA Attributes Cheat Sheet for React
accessibilityariareactnextjscheat-sheetreferencewcag8 min read

ARIA Attributes Cheat Sheet for React

Complete ARIA reference for React and Next.js: roles, states, properties, and live regions with copy-paste JSX examples that pass WCAG AA.

Gaurav GuhaMarch 3, 2026
Keyboard Navigation Patterns for Web Apps
accessibilitykeyboardnavigationreactnextjswcagreferenceguide12 min read

Keyboard Navigation Patterns for Web Apps

A complete reference for implementing keyboard navigation in web applications. Covers focus management, tab order, arrow key patterns, focus trapping.

Gaurav GuhaMarch 3, 2026
Next.js E-commerce Template Guide 2026
ecommercenextjstailwindstorefrontreacttemplatestarter-kitcomparison7 min read

Next.js E-commerce Template Guide 2026

Comparing the best Next.js ecommerce templates in 2026 — what to look for in screen coverage, accessibility, checkout flows, and real-world usability.

Gaurav GuhaMarch 3, 2026
WCAG AA Checklist for Web Apps
accessibilitywcagchecklistreactnextjssaasreferenceguide13 min read

WCAG AA Checklist for Web Apps

A practical WCAG 2.1 AA checklist for web app developers. Covers perceivable, operable, understandable, and robust criteria with code.

Gaurav GuhaMarch 3, 2026
What Are Design Tokens? A Developer Guide
design-tokensdefinitiontailwindcssdesign-systemguidesaas8 min read

What Are Design Tokens? A Developer Guide

Design tokens are the smallest pieces of your design system: named values for colors, spacing, and typography. A practical guide for devs.

Gaurav GuhaMarch 3, 2026
What Is a Boilerplate in Web Development?
boilerplatedefinitionnextjsreactweb-developmentguidetemplate9 min read

What Is a Boilerplate in Web Development?

A boilerplate is reusable starter code that removes repetitive setup at the start of a project. Here is how they compare to templates.

Gaurav GuhaMarch 3, 2026
What Is a Next.js Template? A Guide
nextjstemplatereacttailwindboilerplatedefinitionguide10 min read

What Is a Next.js Template? A Guide

A Next.js template is a pre-built project structure with ready-made components, layouts, and configurations that gives you a head start on building React.

Gaurav GuhaMarch 3, 2026
What Is a SaaS Starter Kit? A Guide
saassaas-starter-kitnextjsreactboilerplatedefinitionguide10 min read

What Is a SaaS Starter Kit? A Guide

A SaaS starter kit is a pre-built collection of frontend and backend components that gives you the common patterns every SaaS product needs.

Gaurav GuhaMarch 3, 2026
What Is Streaming UI in AI Applications?
aistreaminguireactnextjsdefinitionguideux11 min read

What Is Streaming UI in AI Applications?

Streaming UI renders AI responses token by token as they generate, instead of waiting for the full response. Why it matters and how to build it.

Gaurav GuhaMarch 3, 2026
What Is WCAG 2.1 AA? A Plain-Language Guide
accessibilitywcagdefinitioncompliancesaasenterpriseguide10 min read

What Is WCAG 2.1 AA? A Plain-Language Guide

WCAG 2.1 AA is the accessibility standard most laws and enterprise contracts reference. Here's what it actually requires, who enforces it.

Gaurav GuhaMarch 3, 2026
WCAG AA Checkout for React E-commerce
ecommerceaccessibilitywcagcheckoutnextjsreactstorefront6 min read

WCAG AA Checkout for React E-commerce

E-commerce accessibility is not optional. Learn how WCAG AA applies to product pages, filters, cart, and checkout, with code patterns.

Gaurav GuhaMarch 2, 2026
Next.js vs Shopify for Developers
ecommercenextjsshopifystorefrontcomparisonreacttailwind7 min read

Next.js vs Shopify for Developers

Should you build a custom Next.js storefront or use Shopify? A practical comparison for developers covering flexibility, cost, performance.

Gaurav GuhaMarch 1, 2026
Standardize Next.js Frontends Across Clients
agenciesnextjssaasdesign-systemaccessibilitytheming8 min read

Standardize Next.js Frontends Across Clients

One shared structure, many themes. How agencies deliver Next.js projects faster without making every client site look the same. With examples.

Gaurav GuhaFebruary 27, 2026
How to Choose the Right Next.js SaaS Template in 2026
nextjssaassaas-starter-kittemplatereactaccessibilitydesign-systemshadcn10 min read

How to Choose the Right Next.js SaaS Template in 2026

A practical guide to evaluating Next.js SaaS templates. Learn what to look for, what to avoid, and how to pick a template that won't need replacing in six.

Gaurav GuhaFebruary 26, 2026
Startup Accessibility: Small Things, Big Deals
accessibilitysaaswcagcomplianceproductenterprise9 min read

Startup Accessibility: Small Things, Big Deals

Big deals depend on small checkboxes. Why accessibility matters before landing enterprise customers—and how to handle it.

Gaurav GuhaFebruary 25, 2026
React Dashboard Template Guide for 2026
reactdashboardaccessibilitynextjssaasreact-dashboard-templatewcagdesign-system10 min read

React Dashboard Template Guide for 2026

Build a production-ready React dashboard template with WCAG-compliant data tables, keyboard-navigable sidebars, and ARIA patterns.

Gaurav GuhaFebruary 24, 2026
Win RFPs with Accessibility Receipts
accessibilityagenciesrfpwcagcomplianceprocurement8 min read

Win RFPs with Accessibility Receipts

Buyers want evidence, not promises. What accessibility receipts are, why they win RFPs, and how to prepare them. Real templates and examples.

Gaurav GuhaFebruary 23, 2026
Tailwind CSS Design Tokens for SaaS
tailwind-cssdesign-tokenssaascss-custom-propertiesdark-modefigmadesign-systemtheming11 min read

Tailwind CSS Design Tokens for SaaS

Build a design token system with Tailwind CSS and CSS custom properties for SaaS products. WCAG-compliant color and typography scales.

Gaurav GuhaFebruary 22, 2026
Frontend Traps That Slow SaaS Launches
saasfrontenduiaccessibilitydesign-systemproduct7 min read

Frontend Traps That Slow SaaS Launches

SaaS founders get stuck on the frontend because of repeatable mistakes that turn 4-week projects into 4-month slogs. Here are 7 traps and fixes.

Gaurav GuhaFebruary 21, 2026
thefrontkit vs BoxyHQ SaaS Starter Kit
saassaas-starter-kitcomparisonnextjsboxyhqaccessibility7 min read

thefrontkit vs BoxyHQ SaaS Starter Kit

BoxyHQ SaaS Starter Kit reviewed: SAML SSO, SCIM, and enterprise auth compared with thefrontkit on accessibility and AI patterns.

Gaurav GuhaFebruary 20, 2026
Building AI Products with SaaS & AI UX Kits
aisaasnextjstutorialcase-studyintegration6 min read

Building AI Products with SaaS & AI UX Kits

See how the AI Feedback Assistant combines the SaaS Starter Kit and AI UX Kit into a production-ready AI product. Architecture and code patterns.

Gaurav GuhaFebruary 19, 2026
Best Next.js SaaS Starter Kits in 2026
saassaas-starter-kitnextjscomparisonboilerplatereactaccessibility11 min read

Best Next.js SaaS Starter Kits in 2026

Compare the top Next.js SaaS boilerplates and starter kits in 2026: thefrontkit, ixartz/SaaS-Boilerplate, ShipFast, MakerKit, and more.

Gaurav GuhaFebruary 18, 2026
Why Your AI Product's UI Is Losing Users
aiuiuxaccessibilitydesignproduct8 min read

Why Your AI Product's UI Is Losing Users

You can have the best model in the world and still lose users in the first 30 seconds. Here's why the interface around your AI matters—and what to do instead.

Gaurav GuhaFebruary 16, 2026
AI Chat UI Best Practices for 2026
aichatuiuxaccessibilityreactnextjsdesign14 min read

AI Chat UI Best Practices for 2026

Production-ready AI chat UI patterns: streaming responses, document previews, citation rendering, feedback capture, and accessibility.

Gaurav GuhaFebruary 15, 2026
Why "Fix the UI Later" Costs You the Most
saasuiuxdesign-systemproducttech-debt7 min read

Why "Fix the UI Later" Costs You the Most

That one sentence quietly creates some of the most painful and expensive work in your product's life. Here's why—and what to do instead.

Gaurav GuhaFebruary 14, 2026
Production-Ready AI Interfaces with Next.js
aireactnextjsuicomponentstutorial5 min read

Production-Ready AI Interfaces with Next.js

Build accessible AI chat interfaces with streaming, feedback loops, and prompt flows using production-ready React components.

Gaurav GuhaFebruary 13, 2026
Figma to Code Workflow for Engineers
figma-to-codedesign-tokensreacttailwind-cssdesign-engineeringfigmacss-custom-properties10 min read

Figma to Code Workflow for Engineers

Most Figma-to-code workflows break down at handoff. Learn how design tokens bridge the gap between Figma variables, Tailwind CSS.

Gaurav GuhaFebruary 12, 2026
Ship SaaS Faster with Next.js Components
saasnextjsreactboilerplatecomponentstutorial6 min read

Ship SaaS Faster with Next.js Components

Skip the boilerplate. Build SaaS apps with pre-built auth, dashboards, settings, and accessible Next.js components. Cut weeks off your launch.

Gaurav GuhaFebruary 11, 2026
Customize UI Kits Without Breaking Accessibility
accessibilitydesign-systemtokenscustomizationsaasai5 min read

Customize UI Kits Without Breaking Accessibility

Safely customize design tokens, components, and layouts in thefrontkit UI kits without breaking WCAG AA. Patterns, do/don't examples, and gotchas.

Gaurav GuhaFebruary 10, 2026
Next.js Boilerplate vs Building From Scratch
nextjsboilerplatenextjs-boilerplatesaasreactcomparisonproductivityfrontend11 min read

Next.js Boilerplate vs Building From Scratch

Building your Next.js frontend from scratch sounds like full control, but the real cost is 6-10 weeks of engineering time on auth, layouts, and tables.

Gaurav GuhaFebruary 10, 2026
SaaS Starter Kit vs Building from Scratch
saasnextjsboilerplatecomparisonproductivitybusiness6 min read

SaaS Starter Kit vs Building from Scratch

Buy a SaaS UI kit or build from scratch? Real time, cost, and risk tradeoffs with concrete examples from the SaaS Starter Kit. Honest analysis.

Gaurav GuhaFebruary 9, 2026
shadcn/ui vs Material UI for SaaS
shadcn-uimaterial-uisaasreactnextjstailwindcomponent-librarycomparison13 min read

shadcn/ui vs Material UI for SaaS

A detailed comparison of shadcn/ui and Material UI for building SaaS products. Covers styling, accessibility, customization, performance.

Gaurav GuhaFebruary 8, 2026
Form Validation That Doesn't Frustrate Users
formsvalidationuxsaasaiaccessibility6 min read

Form Validation That Doesn't Frustrate Users

Learn practical form validation patterns that feel helpful—not hostile—using production-ready components from the SaaS Starter Kit and AI UX Kit.

Gaurav GuhaFebruary 7, 2026
Session Management in AI Chat Applications
aichatsessionsreactnextjsux6 min read

Session Management in AI Chat Applications

Learn to design robust session management for AI chat apps—covering history, context, error handling, and accessibility.

Gaurav GuhaFebruary 5, 2026
Why Accessibility Comes First in SaaS & AI
accessibilitysaasaiuxwcagbest-practices3 min read

Why Accessibility Comes First in SaaS & AI

Learn why accessibility-first UI (WCAG 2.1 AA) reduces risk, improves UX, expands reach, and how thefrontkit helps AI/SaaS teams ship accessible UI fast.

Gaurav GuhaFebruary 3, 2026
How Design Tokens Keep Your SaaS UI Cohesive
design-tokenssaasaiuiconsistencydesign-system2 min read

How Design Tokens Keep Your SaaS UI Cohesive

Learn how design tokens, reusable components, and WCAG AA patterns keep SaaS/AI UI consistent—and how thefrontkit helps you ship faster.

Gaurav GuhaFebruary 1, 2026